HORDB

ID: hor006455
Uniprot ID: Q25683
Protein name: CHH precursor-related peptide
Gene name: NA
Organism: Procambarus clarkii (Red swamp crayfish)
Family: Arthropod CHH/MIH/GIH/VIH hormone family
Source: animal
Expression: Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
Disease: NA
Comments: NA
Taxonomy: Procambarus (genus), Cambarinae (subfamily), Cambaridae (family), Astacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVN
Length: 33
Propeptide: MVSFRTMWSLVVVVVVVAASLGSSGVHGRSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVNKRQVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVVDEYISGVQTVGK
Signal peptide: MVSFRTMWSLVVVVVVVAASLGSSGVHG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006455_AF2.pdb

hor006455_ESM.pdb

Mass:	411571	Formula:	C144H239N45O57S
Absent amino acids:	ACHIKTWY	Common amino acids:	S
pI:	4.59	Basic residues:	3
Polar residues:	15	Hydrophobic residues:	7
Hydrophobicity:	-65.76	Boman Index:	-9746
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	64.85
Instability Index:	9469.09	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 7821776
Title: Characterization of crustacean hyperglycemic hormone from the crayfish (Procambarus clarkii): multiplicity of molecular forms by stereoinversion and diverse functions.